Swaminarayansurat.com

Swaminarayan Mandir, VedRoad Surat.

Popularity: Safety: Legit: legal Contact info: Contact page
advertising

Swaminarayansurat.com Domain Statistics

Title:
Welcome To Shree Swaminarayan Temple, Vedroad, Surat.
Description:
Swaminarayan Mandir, VedRoad Surat.
Website Topics:
SEO score:
17%
Website Worth:
$1,289 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Primary Traffic:
The country where current domain is most popular relative to the other countries
india
IP-address:
Pageviews per User:
4.7
Average Time on Site:
03:56
Search Percent:
Estimated percentage of visits to www.swaminarayansurat.com that came from a search engine
3.5%
Bounce:
Estimated percentage of visits to www.swaminarayansurat.com that consist of a single pageview
10.4%
Daily Pageviews:
n\a
Load Time:
1.26 seconds
advertising

Swaminarayansurat.com competitors

 

Shree Shyam Seva Trust Surat || Shree Shyam Mandir Surat Gujarat

Shree shyam seva trust surat mandir shree shyam mandir surat

| | www.shreeshyammandirsurat.com

 

Shree Ashapuri Maa Temple, Live Darshan, Surat, Gujarat, India.

Shree ashapuri maa temple, live darshan

| | shreeashapuri.org

 

Swaminarayan Temple | Shree Swaminarayan Temple at Itasca Near Chicago...

Shree swaminarayan temple is located in itasca, il near chicago city.everyday bhajan kirtan and every

| | www.issochicago.org

 

Shree Swaminarayan Gurukul Nilkanthdham | Shree Swaminarayan Gurukul...

Nilkanth dham, home - nilkanth dham in rajpipala, nilkanth temple, varni in narmada, india nilkanthdham

| | nilkanthdham.org

 

Shree Kutch Satsang Swaminarayan Temple

Welcome to shree kutch satsang swaminarayan temple, london (harrow temple)" lang="en-us

| | www.sksst.org

 

Shree Swaminarayan Sanskardham Gurukul - Dhrangadhra

Shree swaminarayan sanskardham gurukul - dhragadhra is one of the best spiritual organisation in gujarat

| | www.ssgd.org

 

Gadhpurdham of Atlanta | Shree Swaminarayan Satsang Mandal of Georiga...

Shree swaminarayan satsang mandal, gadhpurdham,atlanta, georgia

| | gadhpurdham.com

 

Shree Mahalakshmi Temple, Vancouver, bc

Official website of shree mahalakshmi temple, vancouver, bc (canada)

| | www.shreemahalakshmitemple.ca

 

Welcome to Viral Modi, Surat, Gujarat, Financial Advisor Surat...

Welcome to viral modi, surat, gujarat, financial advisor surat, mutual fund surat, investment service surat

| | viralmodi.com

 

Shree Swaminarayan Temple, Los Angeles

Welcome to international swaminarayan satsang organization (isso) shree swaminarayan temple - los angeles

| | www.issola.com

Swaminarayansurat.com Sites with a similar domain name

We found 19 websites. With this list, you can understand how other people are using the domain, similar to yours.

 

Shree Swaminarayan Temple - Karelibaug Vadodara

S.g. P.p. Gyanjivandasji swami is dedicated to guiding swaminarayan devotees towards swaminarayan bhagwan. From daily live katha to the downloads, this website will enlighten your journey to swaminarayan bhagwan

| | swaminarayanbhagwan.com

 

|| b a p s Swaminarayan Sanstha ||

Baps swaminarayan sanstha

| | swaminarayan.org

 

Welcome to Swaminarayan

| | swaminarayan.in

 

Maninagar Shree Swaminarayan Gadi Sansthan

Shree swaminarayan gadi is the divine lustrous throne upon which lord swaminarayan presides in akshardham. It represents the unsurpassed sovereignty and eternal home of the supreme lord swaminarayan

| | swaminarayangadi.com

 

Sgvp Corner | Shree Swaminarayan Gurukul Sarvajiva Hitavah Trust

Shri swaminarayan gurukul vishwavidya pratishthanam

| | swaminarayangurukul.org

 

Swaminarayan Vadtal Gadi || શ્રી સ્વામિનારાયણો વિજયતેતરામ ||

Swaminarayanvadtalgadi.com - an authentic website of shree laxminarayan dev desh gadi – vadtal(part of hindu religion)

| | swaminarayanvadtalgadi.org

 

The Original - Swaminarayan Sampraday

Www.swaminarayan.nu is about the original swaminarayan sampraday consist of vadtal and ahmedabd gadi as established by lord swaminarayan him-self. the website contains shree swaminarayan darshan, names of both gadi acharya, uniqueness of swaminarayan sam

| | swaminarayan.nu

 

Swaminarayanmandirdowney.org

| | swaminarayanmandirdowney.org

 

Swaminarayan Satsang - Shree Swaminarayan Temple...

Largest religious portal of lord swaminarayan and hinduism with a full resource centre for all information

| | swaminarayansatsang.com

 

Shri Aksharpurushottam Swaminarayan Sanstha, Lord Swaminarayan, Gunatitanand...

Shri aksharpurushottam swaminarayan sanstha, bochasanwasi shree akshar purushottam sanstha, shri aksharpurushottam swaminarayan sanstha, socio-spiritual, spiritual, organization, hindu, vedas, hinduism, social, activities, religion, philosophy, scriptures

| | swaminarayansanstha.org

 

Home | Shree Swaminarayan Mandir

| | swaminarayansurendranagar.com

 

Shree Swaminarayan Satsang Pravachan

Minett - responsive html template by entiri

| | swaminarayansatsangpravachan.com

 

Inmotion Hosting | Website Unavailable

The swaminarayan school bharuch - ssb in bharuch is one of the bharuchs leading co-educational independent day schools. We provide a high quality academic education with an emphasis on all round development. We educate girls and boys aged 3-18 on our cam

| | swaminarayanschoolbharuch.com

 

Sarvopariswaminarayanserial.com is Available For Purchase - Sedo.com

This domain is for sale! buy domains and websites on sedo, the world's largest domain name marketplace! millions of premium domains for sale, with thousands sold every month!

| | swaminarayanserial.com

 

Shree Swaminarayan Mandir Sydney Temple

The temple started out as a vision by his holiness acharya maharaj shree tejendraprasadji maharaj, and shared his desire to one day set up a temple for devotees, not only from the swaminarayan fellowship, but anyone who desired a better spiritual future

| | swaminarayansydney.com

 

Swaminarayansampraday.org

| | swaminarayansampraday.org

 

Swaminarayan Satsang - Shree Swaminarayan Temple...

Largest religious portal of lord swaminarayan and hinduism with a full resource centre for all information

| | swaminarayansatsang.co.uk

Swaminarayansurat.com Contact information :

http://swaminarayansurat.com/about.html - Welcome To Shree Swaminarayan Temple, Vedroad, Surat.
http://swaminarayansurat.com/contact.html - Welcome To Shree Swaminarayan Temple, Vedroad, Surat.
See swaminarayansurat.com contact information in whois record

Web Safety

swaminarayansurat.com is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Swaminarayansurat.com Visitors Localization

Traffic Estimations Low
Traffic Rank 6,256,567th most visited website in the World
india 10

Website categories

Currently, we found 1 categories on swaminarayansurat.com
swaminarayan 177 sites

Swaminarayansurat.com Top Keywords

This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.

Keyword Position Date
swaminarayan mahotsav surat live
2 2015-12-26
surat swaminarayan mahotsav
3 2015-12-26
shree swaminarayan mahotsav surat
4 2015-12-26
swaminarayan mahotsav in surat
4 2015-12-26
swaminarayan vadtal gadi org index
12 2015-12-15
vadtal live katha
16 2015-12-15
bochasan swaminarayan mandir
18 2016-01-21
shree swaminarayan gurukul rajkot 45th brahmastra
19 2015-12-23
vadtal swaminarayan mandir
21 2015-12-15
vadtal swaminarayan mandir com
22 2015-12-15

Swaminarayansurat.com Websites hosted on same IP

 

Entrepreneurship Development Institute of India

The entrepreneurship development institute of india (edi), an autonomous body and not-for-profit institution, set up in 1983, is sponsored by apex financial institutions, namely the industrial development bank of india (idbi), ifci ltd. Icici ltd and stat

| | www.ediindia.org

 

Volcano Live | John Seach

Volcano live - john seach

| | www.volcanolive.com

 

Luminous Infoways | Top Leading Software Company in India

Luminous infoways, leading software company in india delivers software development, consulting, maintenance & support service to industries & govt. Sectors

| | www.luminousinfoways.com

 

i Code Technologies

Ict is a leading global provider of business software, offering best in class products that define the market for high volume, packaged enterprise application

| | www.icodetech.com

 

Page Not Found

Quality suites chattanooga - welcome to hotel in chattanooga tn and hotels in chattanooga tennessee. Find information on hotels in chattanooga tennessee and hotel in chattanooga tn from www.qschattanooga.net

| | www.qschattanooga.net

 

Hotel in Hollywood City, Ca, Hotel Packages in Los Angeles

Welcome to americas best value inn los angeles/ hollywood, newly renovated hotel in los angeles. Get the best hotel packages for family & business hotels in los angeles/hollywood

| | www.hotelinhollywoodcity.com

 

Chicago Motels, Rosemont Motels.

Super 8 rosemont ohare - welcome to the chicago motels and enjoy your stay at rosemont motels. Visit rosemont motels with your family and book rooms at chicago motels from www.super8rosemontohare.com

| | www.super8rosemontohare.com

 

University Inn Hotel in Fresno Ca, Fresno ca Hotel.

- welcome to university inn hotel in fresno ca directly adjacent to fresno state university and the new savemarket center. Get information on affordable extended stay at fresno ca hotel and hotel in fresno ca from www.universityinnfresno.com

| | www.universityinnfresno.com

 

Welcome to Motionman

Motionman electric

| | www.motionman.com

 

痛散湯hot情報

痛散湯の事を知るならこのページがお役立ち!

| | www.maglog.biz

Swaminarayansurat.com Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-09-01, website load time was 1.26. The highest load time is 1.26, the lowest load time is 1.16, the average load time is 1.19.

Whois Lookup For swaminarayansurat.com

0reviews

Add review